TCDB is operated by the Saier Lab Bioinformatics Group
>Q3Z8A7|Q3Z8A7_DEHE1 ABC transporter, permease protein - Dehalococcoides ethenogenes (strain 195).
MNNILAIAQRLIRQLLHDRRTMALIIVVPVVVMGLIGVSFPDATVLDYIAPAMLATLALFFSFLLTGISFLRETSQGTME
RLMAAPVSRLDIVAGYLLGFFVFALLQTLIIVLFTIYVLGVNFQGELWQILLFQVLIITGAVTLGIFTSSFAKNEFQMVQ
FIPLIIVPQVFLCGVIWPVSQMPEWLQYLSNILPLTYGVDGMREIMLQGKNLAEVGFQCGVLILFAVITTALAALTVPKR
R