TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3Z8A8|Q3Z8A8_DEHE1 ABC transporter, ATP-binding protein OS=Dehalococcoides ethenogenes (strain 195) GN=DET0813 PE=3 SV=1
MTDTAISLRDISFSYKRIKALDDLSLEIPCGISFGIMGPNGAGKTTLIRIMVGLLRQKSGYLAILGKEFSRQLEYQLGYM
PQIHSLYTELTVSQNIDFFARIYGLRDKTLRKARIEEVIRLVDLWDRRNDAVMNLSGGMKQRVSLACAIVHNPPVIFLDE
PTVGLDPELRCRFWEYFKSLNQKGVTIVISSHTLDDAAHCDRLAFLREGRVIAEGTPSELKAATGNADASLEDAFLYSIR
TGGALSHE