TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q44497|ALGE_AZOVI Alginate production protein AlgE OS=Azotobacter vinelandii GN=algE PE=3 SV=1
MSRKQRISAGLGLGASLLCCNPLFAGPVGPDRNFGMEVKVTAQSEDDRDLDTRSGGDAEGIALDLRPWVYGQRGNWGAMV
MLQAVAATDIIETDPTDPNEEPGGDPANGFSRDSSRDPDKSYLALREFELGTIGRQRIRSLTNEGTWWDIHMESVNWTMD
TSLLRAQAGVAKRFDEYRTDLDNLSAEDKDRTHVFGGLDYQWRQGHWAGFKVHHTSDDGDLPDSQMDVYEDRQSKSYTGD
LTWLSVHLDRDFFNPRSTLPINYWGEFTWLTGEMDRSHFASDGSADHYKDVDVDAWAVDLGLRWNISDRWNVGAAYARGQ
AGEGDDESEQFMQTGLQSNRSTFTGLQTRIHRFGEASRGELTNLQVGTLFTSWKPREDLETSLIYHKFWRVDDDEDLGQN
GISPIEKDGKPALKAGEKDLGQEVDLIITRYFNQGMLPANWGGELDEQSALIRLRSGLFFPSNAYASKGDSKMHRVFVDM
IWRF