TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q44584|NCCC_ALCXX Nickel-cobalt-cadmium resistance protein nccC OS=Alcaligenes xylosoxydans xylosoxydans GN=nccC PE=3 SV=1
MGAVLKAEANIFRSHPFRPMNQATPKKLRSAPCIGVALLLMATGSIQAAEAPPYSVLLQQSLAMAPTMMVQAANVRAAGA
DAAQARAWLNPRFDTLAENLGAPSSGGQSQRQNTYSITQPFEIGGKRGARIEVGERNYEAAQARERQLRVNYAAELAVAY
ATAEAAFGRQALAEENLALANEELTVARALVETGKEATLRTAQAQASVSAAQAIEAAASSDVTSTLARLSALSGATEAYT
GISSSLLSAQPAMTPGGTTTDDSPAVRTAEAERNAFDAQVNVERKRWIPEVGITAGVRRYGWSNESGYIVGLTASIPLFD
RNRNGIDAAVQRVAAAQARLDTVRLEANAARRSAVSQVAATDKQLAAASQGEQAASEAYRVGRLGYEAGKTPLVELLAVR
RALVDARQLTIDARLARVRALAALAQADGRLAFEESR