TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q44585|NCCB_ALCXX Nickel-cobalt-cadmium resistance protein nccB OS=Alcaligenes xylosoxydans xylosoxydans GN=nccB PE=3 SV=1
MMTKNERRQPSWPMIAGVAAAAALVGFGAARGLGSPSGAEVSKLAAAPEKAAASAPAAEPAEVRIPGEYLAAANIAVEPV
SAGGVGSVLLAPASVAAVPGSEAVIASRAAGAVLRIQRKLGDAVRAGDVLALVDSPEAAAMAAERKVAQARADLARKTYE
RESSLFQQGVTPRQEMESARIALDVAQAEVQRAATVAQAAKVSSDGRSVAVVSPIAGRITAQSVTLGAYVAPQAELFRVA
GSGAVQVEAYVTAADTSRIAAGSDATIVLANGAPLAGRVQAVTPTVSGSARAATVVVTPVDANSGLIVGEGVQVRLHTKA
ADANAMSVPEDAVQNLDGRDVVFVRTQQGFRPKSVLVGSRSGGVAQILSGVKPGEQVATRNAFLIKAEMNKAGGDDE