TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q45082 MOPB PROTEIN - Burkholderia cepacia (Pseudomonas cepacia).
MKAFETSQEWHGTVTSTESASGANTTESGSRRLFFASFLGTMVEWYDFFLYGFIAPLVFEELFFPKLNALSGTIAVYATF
AVGYASRPLGGLVFGHFGDKIGRKSMMLVTLLMMGIGTAAIGLLPSVAQIGMSATCLLVALRFVQGFALGGESAAASLMV
LESAQQRRRGLLGAALQAAGPLGVLLASLAVFVVSRLPHDALLAWGWRVPFLVSAVLVVIGLYIRLRVEETVAFRKQQSK
HELTRIPAWETLRSYKWPVFVVLVVSIMESTFYYLTGVYSISYVTKTLHMPGSVAIGAIACANAFALVSVPLYGALSDRL
GRKGVYLLGIVASAIYLNFFFTMLDGRSAMVVVLAVVAAVGVIHAPMYAMFGSFYGELFPTRVRFTGFSMGKAFGTVLGG
GIAPMIAASLAARNHGDPSAIGLYYLCLAFVALCVVLRVRETRNDDITV