TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q45308 GRMA PROTEIN - Bacillus megaterium.
MEFVLSLALILFATKIAGHLSVRLGQPSVLGKLLIGIILGPAVLGWIHNDQFVHYFSEIGVLLLMFLAGLETDLEQLKRN
WKAAFAVAVLGIILPFIGGFGVGELFGLGATYSLFIGVLLCATSVSITVQVLKDMNRLNSREGSTILGAAVVDDVLVVVL
LAIMISFLGTGEEVSLGLLVGKKLIFFIGAVLAGWLVVPKVLDWLTNLKVTEPVVSIGLAICFGYVYFADLMGMAGIIGA
FAAGIAISQTSYRHTIESKVEPIAYAVFVPVFFVSIGLNVSFEGVGDQIGFILLLSVIAVITKLVGGALGAKVTGFSTRS
SLLIGSGMVSRGEVALIIAATGLQESLLLPEYFTSAVIVIIITTLVAPPLIKYIIQSESKITQMEK