TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q46305|Q46305_CLOPE Tetracycline efflux protein OS=Clostridium perfringens GN=tetA(P) PE=4 SV=1
MVNKLSAYKTYLLFSAITAMCFSLVATVMMVYHIEIVHLNPLQLILVGTTLELACFIFEIPTAIVADVYSRKLSIVIGGV
LTGVGFILEGSISSFVFVLVAQIVWGLGSTFISGSLEAWIAEEEKNKDLDEIYIKGAQAGQIGAFIGIVLSTVIANFSVR
LPIIVSGVLFIILALFLWLYMPENNFKPSAPGDLNTFKKMVYTFKSGLKFVKSKSIIMILLAVTLFYGLSSEGYDRLSNA
HFLQDTTLPKLGNLSSVTWFGIFGILGMILSFIVMHFMAKNLKNEDNRKNGKLLLCINILYISSMLIFALTRNFSLMLIA
YLATNTFRIINKPIFSAWLNGHIDDNSRATVLSINGQMNSLGQILGGPIIGIIATNISVSIGIVCTSLLVTPVLVLYIVA
MIIDKKVDDRVGGIDYEENN