TCDB is operated by the Saier Lab Bioinformatics Group
Q467Y6|Q467Y6_METBF Transport protein - Methanosarcina barkeri (strain Fusaro / DSM 804).
MKKYLSLNSKFIFNATISAVAGYRTKLNSFSRNACLFLGYIFLISLSLGIYEVIFNLYILRLGFREDFLGLMLSLVSVST
GLFAIPAAMFCDKAGRKNTLLLSCLLLMFSFAVLYTTTSTFLLAFFSILYGVSSSLKIVTASTFMVENSTSYERMHLFSM
YYLLYTIGVMIGNFAGGILPQTFTSSLKIDPTDPAAYQLSLYASLAAVLISLLPLIFIKNKKSSLPEKTALLSTFFSTLR
SKTIRKLILVNGLIGMGWGLALPYFNVYFDIVLGASSRQIGFIFSLSQVVMMFTLLFVPILTERLGKVKVVALVQLSSIP
FLLLFTSTSLLTIAAFGYIMRSAIMNMSNPVLSNFNMEVVSEEQRATVNSLIWMSCYTCVGLSTYAGGLMMAHNYYRLPF
LLTCVLYVVATVLYYVFFEKMEKEQKNLEVSI