TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q47455|PCOD_ECOLI Copper resistance protein D - Escherichia coli.
MNDLIMIVIRFLLYLDLMVIFGLPFFQIYGISGVRHETYNLTNFRSFITFAVVTGIILTGINMLLVSNAMSGVTDLRELS
IHVIEMVIEETDVGISWIVRLCALFTTLGALFLYTNKRVLSCLLMTMSGGVALATLAWGGHAVMHDGLHYYLHLLSDLTH
LGAAGAWTGALVAFAILLMRRNEHNAQSVIVISDSLAKFATAGTVIVVALILSALVNYLYIAEGNLTPLFNSSWGRILLA
KTALFVLMLLLAAANRFHLGPRLEVMVREGNYDRSVALMRNSILTEFVVAIIILGAVAWLGMLAPSQVS