TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q48217|OP29_HAEIN Outer membrane protein P2 precursor (OMP P2) - Haemophilus influenzae.
MKKTLAALIVGAFAASAANAAVVYNNEGTNVELGGRLSVIAEQSNSTRKDQKQQHGELRNAGSHFHIKATHNFGDGFYAQ
GYLETRLVSDYQSSSDNFGNIITKYAYVTLGNKGFGEVKLGRAKTIADGITSAEDKEYGVLENKEYIPKDGNSVGYTFKG
IDGLVLGANYLLAQKREAYKTDAATPGEVIAQAISNGVQVGAKYDANNIIAGIAYGRTNYREDLAELGNKSGKKQQVNGA
LSTLGYRFSDLGLLVSLDSGYAKTKNYKDKHEKRYFVSPGFQYELMEDTNVYGNFKYERNSVDQGKKAREHAVLFGVDHK
LHKQVLTYIEGAYARTRTNDKDKTEKTEKEKSVGVGLRVYF