TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q48AX5|Q48AX5_COLP3 TonB-dependent receptor OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=CPS_0067 PE=3 SV=1
MTFSKSATCLAITASLFNVTASAEQQANNDTSNTGNTGNTGNLETITVTSDFRQQNLQNTPASLSVLTDIEINQRNARHL
EELVAVSPNVNFASGSQRARYYQIRGIGERSQFQEPINPSVGMIIDDIDFTGIGSIANLFDVKQAEIFRGPQGTRFGANA
IAGMINITTNEPTEDFEGAVQLGVGNYNSYDMGVALSGPASDTVNYRLAVNQHNSDGFTENIHLQRDDTNNRDELSVRGK
LAIEASNDLTIDLAGFYFDFDNGYDVFSLDNTRETYSDQPGFDQQETAAFSAKFTYTGFESATLLAIVSHSDTDLGYGYD
EDWAFGEYEWRSDDPVYTPDPCITPSGCLADFDGYSSTDHYYRDKTVLTTELRAVSNQGQEIFNGSTAWVAGVYFKQDDE
DLLRQYTYASGDFTSINESTSVALYGQLDTQIAEKWSLMSGLRIENRSADYNNSDLFDDRIDDTMVGGKLVLSYQQNEDS
MWYGSINRGYKAGGHNTDGTLPEDLRTFDPEYLLNYEIGYKVSLLENSAYVRTSVFYMDREDMQVKSSKTIIREDGSSEF
ISYLGNAATGSNYGVEIEGAWYINDLINVYGSLGLLDTEFNDFVNADGVSLSGREQAHAPNYQFNVGINVQPTDHWLINL
SVDGKDSFYFSDSHDEQSESVALLNASVAYIQDNWQIKIWGRNLANEDYANRGFYFGNDPRDGYTAKQYTQLSEPLVFGA
TLDYQF