TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4DTX8|Q4DTX8_TRYCC Uncharacterized protein OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053509233.170 PE=4 SV=1
MLNWWLIVLLIFVVILCVGLSVYLLFYFTSEEDDGEAYGAKVIVVIGMVISMGVVLLLPLDVANAVDPTISNKYKNTLNM
TLMWQIVLWLLFCMTFIIVPFVMFFYEAYDPDNNRISKQIIQAIIYTIGILSIFFIICGICYTFIGVTIIPILTYEGFPQ
FISDIQYISYNGTGIFINIEIPVNFFTYCVGIMCFFGWIAFFIYGGLGIISFPLDLIFGFIKRTKSINNYHFKEEMNIIA
LKGDILLKLSLNLQKKCRGIISISQRNKIHILRNETYILEAQQEQLIWAYTKAGGSPFIIYGRLLLGIISLFISIIWILH
IFIYNTFHKSSFLNQILISLDHIFGLFGIIIYGILIFYLIWISFEGQVRLGMRFIFFQIYPLKPHDTTLNAFLFNISLSL
LISPAIIEFASRSFQEYGPRTTINALMNIYVLHLKGIGIFIRWADVCFTGISLLSIIWVLLCPVHKRIKDPTKLRL