TCDB is operated by the Saier Lab Bioinformatics Group
>Q4FKW8|Q4FKW8_PELUB Hypothetical transport protein - Pelagibacter ubique.
MINKNNVAYIFLFLAALFWSGNFLVGKFASQYQVPPFSLNFYRWLFAWLILAPFTIQELFNKRSYILENYKYYTILGITS
VTIFNSIVYYSLNFTQVISGVLMISTIPVMIIFISSILKIEKTNTFQIMGVTCSFIGVVLIITKANLGILMNLDFNKGDI
TMVFGMLSWATYSALLKKKKHELSQLGLLEVVISFGFIFLIPIYFIEYQMGFRIVLNQNFYMILFYVVLFPGLASFIFWI
KGVALIGANRAGVFLHMMPILSAIMAMIIFNEKFMFYHMLGAIFILTGILLSNRKIKNA