TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4PT23|Q4PT23_ARATH Nodulin MtN21 family protein - Arabidopsis thaliana (Mouse-ear cress).
MKSVVAMVAVQFIFAGMFILFKITVDDGTNLKVLVAYRLSFATIFMLPLALIFQRKKRPEFTWRLLLLAFVSGLLGAAIP
NILYLPGMARTSATFSAASSIISPLITLVLGLVFRMETLRLGSNEGRAKLVGTLLGACGALVFVFYKGIEIHIWSTHVDL
LKGSHTGRATTNHHVSILGVLMVLGSNVSTSLWLLLQAKIGKELGGLYWNTSLMNGVGSLVCVIIALCSDHDWEQWQLGW
DINLLATLYSGIVVSGMVVPLVAWCIATKGPLFVTVFSPIRLVIVALIGSFALEEPLHLGSIIGAMIMVGGVYLVVWCKM
KEKKSASTTSDHIETNKNNKELDLGNLSSVNRDVP