TCDB is operated by the Saier Lab Bioinformatics Group
>Q4QH25|Q4QH25_LEIMA Nucleoside transporter-like protein - Leishmania major.
MSKLPQAAMLGTSLVVGVSMVMGPKAINSAPSFMLEYYKYLAGNKAAEALSPVFWRNILNFYTVVTMVAQAIHEPTNMTS
FMCRFSLLFRLEVSCVLMMIELLVILIMPHTHAPEYGAIAAMMIVAYVGGAARAYFENTGYALFGPCPPIMMTGMLVGSA
VSGSVVSVLQITLKASMSDTYSAVLTQSLIYFCLAIGVIFLSGLFLMILPYNSYARRYVAEFRSSRGLWANIYCPRKVVK
ETSDDGACGKTGAAGLQDRAACRYLADSDSEKKAEMLLETEHGKVAASGNRACHHLSLLYDDRFFTRERLEAEPTQEFAL
EPGSHDGAAVNATQTGACDCAHSQMTSGEVSKEVVTQKTAELERDNNDLPAAADRMPTTAELLQEVRLWPVIKKIYPMMI
ACFLTFCITYLVYPGIIVAVDSADGWFTTLTIAAYNFSDLVGRLLTLWRRLWPSRKVILIASITRIIFIPLLVLCAVHKI
PSKAAAYVFTVIMGLSNGFVGSLSMIYSPATPSLSTDGERAMAGQLTGACLLIGCAVGSLIQLAEVLPFA