TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4QIJ6|Q4QIJ6_LEIMA Uncharacterized protein OS=Leishmania major OX=5664 GN=LMJF_07_0910 PE=4 SV=2
MLRQSAFSSSSGLSAASSRGSCTYTDSNTPLRSEASTLEPLAAGLATAQPSALVTPVVNVLSASAVPEPHALPLVVSWNA
RSRGAENVAPGPPVREDNALTTTATTGAGSVGADGEEEPLCVPATYSTAADLAPDVANTDAGSSWCLRTVDEATTERSAS
SLADCSGAPESRTAERLPTQQRPQRRRQHSQQLLPTSLPLLPIPVSTTHTYPQSHQSAGLSRRAAGPSELPPSSHTAASL
PRPSSPLMTSSVAGLSADGRRPKPHRRRPSQASSDDITASSMITAPCRVTSGTASQSEVVLATSPSIGRAPVASGSSAGA
AGSASVGSPRRYTALGGGGDPRLDAWEIDEEVAQLARSLRSQIAGQPFVLTPPFGASPTAPAAATSRPSSSYSDFSTGSR
GGGGGSGQRRTRCSPSHAAPMAAATTTGFGEDLAATTACTATAAIGRGLLALLDSSTSSAQTSMDLSGAARRLTTPQYRL
SKSRQLSLSTSQRSPPSAQGSRTRPQCFPSVQPHPGVGGDAVARNDDGVRRDGVDSAAALSHSSDPGQQTPAMCCDARPL
GVPPSSSSHLSTVTDAVPLRAARGSWAAAEVVTQTADAEHNQRRSRVAGDAAAPGLCEGFDAGLSDVAELRRRLLTEDFF
SSPCRKLRRDGRFPWKLTTSVLLCILLLVHVTWYQLPLACANEAMRLAITKHFMGDDAYFSKDQGDIVSAPTEWMENLYA
SIERYVQVYYNLTNASSSEMTYRYNNANPTSWCGTGIERTNSVVDGGEGNSMAREGQWWWRRRGPAGWRPSLLWNARAAA
SPSPFSDPASVAGPCVHSATATAASALGNSEELPPPYIPVSVIAPVLMRVEVDVYSRREGTQHKRVKLSPLKTAAPVRWL
SGEAAAENHGGHADESGEEAVADAVNLEHRWLTFSVDADHPLGPFAKHKEAVRLLRLARRQERHRATERTTGDAAGRPAE
FEGASATDATALPGSAGGGSWTEVDAALSVVCMPRYDDLSGRYYRPCASTQATTIIGGAAAAAAGMSTHIVPEFSLMDNV
RRIQLEVTLRHETDEVDYLISAAAAAASMGGSAAKKVARGANAFSVGNLEIRSASSSTGRLKSAFAASASAVFQWHVVKD
ITVHPGGLVETQLHVSTRVWPLGLLRNFWTRRLMTVLLGALAVLQIVLELRALQRIAQHKRRLGRERAAFLARQLQYAPI
GGGAEHGASKVWTLPTHTASLQPAILSTKTTVYEWGMPVSLPFGRPSRPPQSGRIAGYAKATDSAAARAPANSYPSGVKP
SNYGTIESRHDDDDHAGRPGSHSETVLPPSLMLDTSLSIIASQGQSSYSRSRCASQEGAGDASVLPSWPCEEAASFFPLR
NSAESHQHGFDSSVGPPTWIPSALRRFLLGRLAQLLGTPTSSQRGSFPNTPVPCTPGHYPRSDDGSDMRASGAPESLPLR
FCINSSGTPVSAVASHASFPPPLHAPLTPQLAERIAERSYVDVRTAWRHHLQQSTGAGWHRVAIIAAAFTLSYSALLLAP
LLPFAEVAQTGAYYAWTSVLLGVAALMSCVLLLSYLRFFPTFYFPVMASIHVVPKLFLFGMCVSPLFLGFAFFCVIAFGA
HSNGHFATLSSACMGLYFTAYGDSLLATRDVASDTPYAVTAFFASLLVVSFVLTFMMIMLNMAMTITQHEWLRLRRRFGA
ALSTSSVLFAVRSREEAREEAIEAVRANLEVLWLMLGEDEEEERQKTGAAKAPAATPSTSSADAARLSQPATSLDPSRTT
TIRESDDDGAAGEEGAGGGGDQKRRLRHRRRCHKQRHAHQIREADDAHSAGSPFHAGHCDRTETFAVDSSYEVSAASTAP
PDSR