TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4TT81|Q4TT81_CAEEL Protein F53F10.8 OS=Caenorhabditis elegans GN=CELE_F53F10.8 PE=4 SV=1
MSECGVQCILSIIVVGFVWGATNPLLRAASKDLENKKNGIILGFLKSFLNWRFSIPFALNQSGSVMFNALVVNFPVTVVV
PCVNAIQFIATITVGWLMGEKMQVSTRKQKIGMTISSLAIIGMLIID