TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q4V8E5|MFSD3_RAT Major facilitator superfamily domain-containing protein 3 OS=Rattus norvegicus GN=Mfsd3 PE=2 SV=1
MHGKLLPLAGLYLVQGLPYGLQSSLLPILLRARGLSLTRVGLTKGLYAPWLLKLAWAPLVDRRGTPRVWLTFSTVCLGLV
CGLLAVLPPPQAGQTGLPTTVMGLLLLLNLGAAVQDVALDTLAVQLLEPKELGPGNTVQVVAYKLGSALAGGGLLVFFPT
LSWPLLFLLLTATYWLAAALAWAAPALGRLSRPQVSEHTPHTSYLLQDLLAVPGTLWTAGFVLTYKMGEQGAGSLFPLLL
LDHGASASDLGLWSGLGAATCSIAGSSLGGALLARHCSHPRQPLKLLRSVLQLRLGGLACQTALLLHLNTPGASLDPGTV
MRGAALLSLCLQQFLGGVVTTATFTVMMHCSQLAPRALQATHYSFLATLELLGKLLPGTLAGVLADGLGPRLCFAAFLVL
SALPVLDLRLAPSNLT