TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4VSJ2|Q4VSJ2_BURGL Hypothetical protein toxF - Burkholderia glumae (Pseudomonas glumae).
MPTSLSLSTATLAGAALVAGALVPLQAGSNAALGRALGHPLWATVASLLVSLLCVLPALFVFHAQAPLLGRAAQLPVWIW
FGGVAGVIYITSALVLTPRLGATSFIVSVIAGQMLTSLLIDNYGLMGLPVKPANPGRVAGVLLILAGMLLVQWFTPATRP
AAGQAGAGARPSAEAGPHAAREIEPNAHPHT