TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4VSJ3|Q4VSJ3_BURGL Probable RND efflux membrane-fusion protein - Burkholderia glumae (Pseudomonas glumae).

MKSSQLILVGTAMAVVFGGLFLWHGRREAVANEAPPPSPPMSVTASKVRVGTAPSTLDAVGTLLAVRQVMIAPEVAGRVT
AIHFTPGSQVRQGEPLVQLYDDPERAQLASLQAKAVFAKSQLARSQTLAPVGAEPRSVFDQHQFDYRSASADARQVEAVI
RQKLVRAPFAGEIGIRQVNLGQYLNAGEAIATLTDLDTLYANFTLPQKYVGQLRVGQAVHLATDAYPGRDFVGKVTTIEP
RVGDATRNVTVQATLDNRGHPLRPGMYAHVTLDLPSRPDVLSVPDTAVQSSQDGDMVAVVEKPNAQGIGTVALRKVRTGI
AGGGRIEVLEGLRAGEVVLTAGQVRVAPGARVKIAYDRHDGDQASLAAGSRDVAAETAQ