TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4VSJ5|Q4VSJ5_BURGL Putative outer membrane protein OprM - Burkholderia glumae (Pseudomonas glumae).

MPAGAAALLLAACTMAPHYQRPAAPVSDRFPSDGVYATQPGADAAHSADGRAAADLGWRDFFADQRLQALIEIALKHNRD
LRVAVLNIEAARAQYRITRAGLLPSLDGSGTGNIQRLPAGVSTTGAADMTRTYNVGASASWELDLFGRVRSLKDAALAQY
LSTAQARKAAEISLISQVADQYLTLLSTDDLLKVTEDTLKTARDSYHLTKLQFDNGTGSELDLRQAQTVVEQALANQQAQ
ARARAQALNALALLIGQPLPDDLPAGLPLDSQGLLADIPAGLPSDLLTRRPDIMEAEQTLLAANANLGAARAAFFPRISL
TAAFGTASPTLGGLFKAGTAAWSFAPNLALPIFEGGSNLANLDLAHVRKRIEIANYEKAIQTAFREVSDGLAARGTYDQQ
IAALSRNEAAQRRRYALSDLRYRNGADSYLAVLTAQTDLYTAQTTLISARLARWTNLVDLYRALGGGWIEHNGDQPREAD
APPAGASEKGAAPDVGQNDSATPERR