TCDB is operated by the Saier Lab Bioinformatics Group
>Q4YNK7|Q4YNK7_PLABE Putative uncharacterized protein (Fragment) - Plasmodium berghei.
MKNSNDNIIYNSPNSKIKVVSNNNFKDRKKGMNHKKKKGISINQITLFKIHNYIYKTFVFLLCLFIVILVLYASIDISQN
YGPIIILYIIMLEFGSMLISYILLQFPFFYLILKNMFTRTSNINKYSHQYSPLYYENPSDSDDKDSIDVKRRETKQRRKT
FGFFNLNNIDHNKYSIKKNILPTKLKVYNKEESDKYEYGNLNHVLNTNLSNTKSRSADEAENYIIEDTNMNHNGENVNNK
SKKGNQPIKIRNHKRENIYLDDCNMWIRNSIKKSRVKGNFNLTRSLSFNIKLSENNVILNDSRNIDNLRIYLNHRSSKYE
KKKNQIKPLKLFAYNKYAPLTFSTPYKYNVPSDIFKTNTGESKILSAEISESSNDVNGLLHKNNDKSYSEEKYHLDKRKT
DNEFYTGKSAILFSNKHTKQYMRKKTFMYDDLDSLNIYKNKKHNRKNKKKSIFCKIKCFNKIKNILFFFVNYNIKSSKTQ
NTMLLFFRGLTLYIKHQFIQHLSYEPVWIIAILIRIILWCIVWLWAAGYMTRPPKNYKINAWNMKSIPPLYGYIECTFQW
CGVLDYLFGLYFSNNKLKYIFSFFSLIDFITTPVSSFIMNFLWQNDYHQTYWFLILGPLRFLRLVRAESTMSSCFFWLSD
VKIIIIGIIILSLAILFTFSGIMYILEAPDIERQFISPLDFVYFGVITMSTVGYGDYTPVTPAGKCLTMFIIVTCFTFVG
AQLKRLKEAMFSPKTIMGIIPKPDDDYILILGPVSPIQLLYICKGINNSFPNSVESIFLFTPLPVIIYRYVYGSIIKNTN
IKICINGGNECFICPSIIYDAVINARALYILNNVDSEKYTLLNQQIFLASNNFNFNNNDKNQRIRPEDILHNNIINKFTG
DKKKTWKFTDIYSEHKNQINKNNMLNLEMNINVNDSHMIREKDDQECIL