TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q50E62|Q50E62_MOUSE Aromatic-preferring amino acid transporter - Mus musculus (Mouse).
MERSEEKDGSNKPAGQEQGSGTAGLMLKREIGLWSAVSMTAGCMIGSGIFMSPQGVLVYIGSPGASLIVWATCGLLAMLG
ALCYAELGSLVPESGGDYAYILRTFGSLPAFLVIYVYVLVGRPAGITAVSLSFAEYVLAPFYPGCSSLPQVIVKIVASSC
ILLLLLINFWSSRMSTVLMNVCTTAKVFSLLVIVVGGAVVLMQGHASTESLLFAFHNTTQQAGRIGMAFYQGLWSFDGWS
NINTVIEELKNPKQNLLWAVMTAVPLVTILYVLVNISYLLVMSPSEILSSDAIAVIWGDRVLGSWAWLVPLAVALSTFGT
VNGGFFSGSRVCYAAAREGHMPQLMSMIHVNRLTPAPAQIFTTAVALLLVIPGNFSTFVNLLSFLSWLTYGTTFACLLYL
RIKTKNLPHTYKVPTFIPAIMLLVSLYLVLAPIIDHPQIEFLYIFLFVLSGFPVYFLLFHFQCQFKCIQTATMHLQLLLE
VAPTTKDH