TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q51073 RND PROTEIN - Neisseria gonorrhoeae.
MAKFFIDRPIFAWVISIFIIAAGIFGIKSLPVSQYPSVAAPTITLHAIYPGASAQVMEGSVLSVIERNMNGVEGLDYMST
SADSSGSGSVSLTFTPDTDENLAQVEVQNKLSEVLRTLPATVQQYGVTVSKARSNFLMIVMLSSDVQSTEEMNDYAQRNV
VPELQRIEGVGQVRLFGAQRAMRIWVDPKKLQNYNLSFADVGSALSAQNIQISAGSIGSLPAVRGQTVTATVTAQGQLGT
AEEFGNVILRANTDGSNIYLKDVAKVGLGMEDYSSSTRLNGVNTTGMAVMLSNSGNAMATAKAVKERLAVLEKYFPQGMS
WKTPYDTSKFVEISIEKVIHTLIEAMVLVFVVMYLFLQNIRYTLIPTIVVPISLLGGFAFISYMGMSINVLTMFAMILVI
GIVVDDAIVVVENVERIMAGEGLPPKEATKKAMGQISGAVIGITAVLISVFVPLAMFSGAAGNIYKQFALTMASSIAFSA
FLALTLTPALCATMLKTIPKGHHEEKKGFFGWFNKKFDSWTHGYEGRVAKVLRKTFRMMVVYIGLAVVGVFLFMRLPTSF
LPTEDQGFVMVSVQLPAGATKERTDATLAQVTQLAKSIPEIENIITVSGFSFSGSGQNMAMGFAIFKDWNERTASGSDAV
AVAGKLTGMMMGTLKDGFGIAVVPPPILELGNGSGLSINLQDRNNTGHTGIAGEGNELIQKMRASGLFDPSTVRAGGLED
SPQLKIDINRAAAAAQGISFADIRTALASALSSSYVSDFPNQGRLQRVMVQADEDARMQPADILNLTVPNKSGVAVPLST
IATVSWENGTEQSVRFNGYPSMKLSASPATGVSTGQAMEAVQKMVDELGGGYSFEWGGQSSEEAKGGSQTLILYGLAVAA
VFLVLAALYESWSIPLAVILVIPLGLIGAAAGVTGRNLFEGLLGSVPSFANDIYFQVGFVTVMGLSAKNAILIIEFAKDL
QAQGKSAVEAALEAARLRFRPIIMTSFAFILGVVPLYIAAGASSASQRAIGTTVFWGMLVGTLLSVFLVPLFYVVVRKFF
KETAHEHEMAVRHASKAGITGSDDKQY