TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q52663|BZTA_RHOCA Glutamate/glutamine/aspartate/asparagine-binding protein BZTA precursor - Rhodobacter capsulatus (Rhodopseudomonas capsulata).
MKKSVFFGSVALAALVAGAASASTLDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAAAVLGDPMKVKYVP
LTGETRFTALASGEVDVLVRNSTWTFSRDTELALDFVAVNYYDGQGFMVNKSLGVSSAKELDGATICVQTGTTTEMNLAD
FFKANNMTYTPVNIADDAEGQQKFAAGACDSYTTDASGLASSRATLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVR
WSFYALVAAEEYGITKANLEEVAASTQNPEIRRLLGLEGDMGKKIGLDNDFAKRAILASGNYGEVFEANIGASTSIGLAR
GLNAQWTQGGLMYAPPFR