TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q52665|BZTC_RHOCA Glutamate/glutamine/aspartate/asparagine transport system permease protein bztC - Rhodobacter capsulatus (Rhodopseudomonas capsulata).
MSDTSFVRTEMLAPRPAPVSQVGAIKWMRENLFSGPLNTALTVFGLLATVWLVQAAAPWLLHGVWNANSLTECRAIIAER
WGPEATGACWAVIRVRWNQFLFGFYPVDQYWRLFVTFAGLFLALAPVLFDALPRKLIWGTLLYPLAAFWLLWGGPIWGPV
SVLAGFAILGLLFTALAPKLGVPVSAGIGLVVAALFWLYAAAPIEAALQSALPLALPEVDSDQFGGFLLALVIGVTAIVV
SLPLGILLALGRQSDMLIVKSLSVGIIEFVRGVPLITLLFTASLLLQYFLPPGTNFDLILRVVILVTLFAAAYIAEVIRG
GLAALPRGQYEAADALGLDYWQAQRLIIMPQALKISIPGIVSSFIGLFKDTTLVAFVGLFDPLKGISNVVRSDMAWKGTY
WEPYIFVALIFFLFNFSMSRYSMYLERKLKRDHR