TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q52666|BZTD_RHOCA Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein bztD - Rhodobacter capsulatus (Rhodopseudomonas capsulata).
MSEPSYDHQVDRSHMQVSDEIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKII
VDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETAMYYLEKVKIPEQAQKYPGQLSG
GQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNN
PHDFFHNPQSERTKQFLSQILGH