TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q53716 ATP-BINDING PROTEIN - Streptomyces antibioticus.
MTVRGLVKHYGETKALDGVDLDVREGTVMGVLGPNGAGKTTLVRILSTLITPDSGQATVAGYDVVRQPRQLRRVIGLTGQ
YASVDEKLPGWENLYLIGRLLDLSRKEARARADELLERFSLTEAARRPAGTYSGGMRRRLDLAASMIGRPAVLYLDEPTT
GLDPRTRNEVWDEVKAMVGDGVTVLLTTQYMEEAEQLASELTVVDRGRVIAKGGIEELKARVGGRTLRVRPVDPLQLRPL
AGMLDELGITGLASTTVDTETGALLVPILSDEQLTAVVGAVTARGITLSSITTELPSLDEVFLSLTGHRASAPQDAEPAR
QEVAV