TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q54D51|Q54D51_DICDI Uncharacterized protein OS=Dictyostelium discoideum GN=DDB0184423 PE=4 SV=1
MRPLQQWSLYIVSIIIIVILKIENCLSSTNFMPTLAVERRSTLFIGNLTIESSERDLTIGLLPGTGNNFEWLVFKDGFSL
MEGRRVQSDESNDALKFQCVTSYDSGIYYFKQNDPTNTGYNIETERFILNVIGNDTETLVMIREPSSIVMSGTSFSVQPV
IGFGRAKLPTWKGESRGRIEPVILESPSNGKNMHFLLQFRGVDIDLERKETTFNTLSLIGEPGVYRIGFIDTDTCEMYKS
TMEITVIGTLNSLYFEWSLSAFIVLLIIIVSLVINFIAKHKVKSKGFLSLKMAFLTPMESIYKFKGESIRFYFKSQRLLV
FQCLFFTFISLVLFIPVTVKGDNKFRDMILLSQANWNANSPFLFFYQVQVFLLFCSLIICYTRFNDERIYLSHDSNHLVT
SRSVLLTGLPRSLTNVQMLKDFLQTGYSNGVYSVSIILIKIFSQSDKDNDLNGRLEHIYVDPNTDINQLPSELKVESTGK
AFITFSCVSDAHLFTNQFSSYKWTKSLIKRITQPVIPQEYRTELGTDNWRAHPAPRVSDILWTKLHDPANFRNVGWTILQ
MIGITFFFLVIVFFAIIFYETQFSIIDTISPIDYGTKQAMLVSLTSYLAYYFCPSIILMGLNHSLPGIIRFILMRSNNYV
RSFSKSKVMLITFIAQSLIIVIFPSAYFLINVNPDSDHVSNQNLFLVPIKFLRRGGSFYIHFITIFAMLTPFLELSNLSD
IVYKILFHRNLKTEEIFSFEPLNLKKQYLNSLLLVMMIGCYGPIFPLLWVFVLSYLIVKFYLVKYVCIASKAPIPPSDKY
FAVSFQQCIWFILTVISTFHFYYVVSFGRVDLMCVYIFLVVVAFGKYFPSCSKSLCYSFFDGAVLPCFSKDNGKNKKSNS
IDPNDSDYYDDERDQDYYQDSDDSDYDDDDDDQYEDNHRNNDGYYQYDDDDDDEEEDDDDEEEYEDEDEYEDDQVELRRR
MYGNRYNDNEYTEQDSSGEEYDVNSPPEYYYDEDRGEFVQQFPSSIHRRNNNNMKKQRANYSNNNNNSNNNNNQKQQQQQ
QQQQQQQQRQQQQQQQQQQQKKQKHQQQQQQQQQQQQQQQQQQQQQQQHYNVNLTESFGSRPPQPISNGVSSAVSQPALP
LSAIHSPLPPPPQPATTTTTDSNTDSNSGLHDDLINEYLKEPNQDDVKLNIHHKSKLKQKILKIKQSYTQDQGFGFMSRF
FGRYKLPTPESMTVITYLSPYFGLDISQCENVKDIEEEEDQDINDDDYEYDDEDNLGGGGDYEDYSS