TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q54ET0|GRLE_DICDI Metabotropic glutamate receptor-like protein E OS=Dictyostelium discoideum GN=grlE PE=2 SV=2
MKIKIGNILKNVVILVIFSLFISKINSEVVKPNPAKPDELVIAFMSPYFDPEYTQYSGAAEYALSKFNETFKTKYSKTIK
LHTFTDTNDVIDSLDLVTMPVNGIVGPAYSGSSSTACLVFGAFAVPSISFYATGASLSNSGSYPYFQRVMPDDRLQVQAI
LSLLKKNGWTRVSCIHTNEDYGNGGADQLVQQSNAQGITVNTNQAIDPVDNGIAPEQLYYDIVFDNLEAAKSRVIVLYAL
FPPDCLEIWKQAKARGFLGEGFTWIVTDGCAELTGGTDPDLLGVLATFPSYGLGTEAYTDFERTIVNDYNNNTGDAFYKG
ASFSYDATYAMLMGIEAVLAKGGDPWDGEQVRTELRNLKFNGITGTIAFDKNTGDRLYGEFALLNLINSTKGSFDPIGKI
NPDSGEITLKSDILYSGPTYKVPSDYQVVVFDRTLNIVLGVITGVCVLIVIGIGSVIALQWRKFRYSSPLFCMFIIIGAL
MGLASVFTLLPTPTTPLCSGFPWLLGLGYVIVFGTLFTKTWRTWRLFSNARKFKIIRITNKFIITLVGGFVLLESIFMII
WTAVDRPIPLAEPIFKAGEAQLQCTSDSEAWWYVFVFYKVFYILFGVFLAFKTRNVVDSLNESKPITLALYNLTFVMVVA
IALGFILRDNPIAIIVIQTIAILLGFTVTVSVLFLPKVWMILSGQQHSMDSIGTSMDSMGRSNGNTTEAESTRGYTNKDY
NNQSVGRSFSAHATGFKDVAPSNHPQLGIVYTGGDNFPRVGSSQTAASRSEAEINVSKDVLAKANKKNEEEFGEFFLKPS
EDNILKKKKKKKNNNK