TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q54V96|T144B_DICDI Transmembrane protein 144 homolog B OS=Dictyostelium discoideum GN=tmem144B PE=3 SV=1
MVNPQVIGYIGAAVASLFFGSNYVPVKNYPTGNGLAFTWVMSVGTLVVAYCAMFISKDYIFDPWGLLGGTLWSIGNFCVI
PIVKTIGIGLGLLLWCCSSIITGYFTGKFGWFGIDKQKVSHPALNWIGFACIVAAVIFFFFIEPTIEEKDEHSYSSIVDD
SEIGNNGIDNNGYNSINNNNNNGNNKRRSGAFNKQPKKSIFERMPPPYNTILGIVLSVFSGIMYGVNMVPMQLWKQSNVD
ASPLSFVFCHFSGIFLANTAVFIVYSIIVRPPQIFPQTIFPSFFSGLLWGIANVGLMVATQNLGYTIGFPMGSGGPMIVS
SLWSVFYFREIQGVKNLLILLISFIFLGAGITILALSH