TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q55281|MNTA_SYNY3 Manganese transport system ATP-binding protein mntA - Synechocystis sp. (strain PCC 6803).
MAATLSRLDISVDGVSVTYNNARLALYNATCTVEPGTITALVGPNGSGKSTLFKSIMGFLQPSQGRVRIGGFSVQKAQKQ
QLMAYVPQADEVDWNFPVSVFDVVMMGRYGYMNVLRIPSAKDRRLVMESLERVGMVKYRDRQIGELSGGQKKRAFLARAL
AQEGKVILLDEPFTGVDVKTEKGMIDLLMELRDEGHTILISTHDLASISTFCDHTILLNRTILAQGKTEETFTKENLELT
FGGLPMLSLNQMFESTEVDA