TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q553K4|NRAM2_DICDI Natural resistance-associated macrophage protein 2 homolog OS=Dictyostelium discoideum GN=nramp2 PE=3 SV=1
MNNNNNNKKLNKENLNEIENWNEIELTDYKKQGLDEGTSSNIYLFESNGNVVNGSIEDSPKQQQQQQQQQQQQQQQQQQQ
QQQQQNIISSDEEIEDKPFQDRDSNIGDGSDIDSSGDSIDIENTDYSILVPFEDEENNNGSKSKFSIKKLKSFLGPALFI
SVGYMDPGNWATDLEGGSRFGYQLMWVLLFSNIMALFLQTLVIKLALVTKNDLAQQCRKEYSKTVNIFLWLILELAIIST
DLAEVIGTAIGLNILFGLPLIAGVAITSLDTLLFLAIQRWGIRKLELLILLLLSMITMCFVIELFLSKPIASEVFSGFVP
RLNSDSVMVATGIVGATTMPHNLFLHGSVVKSRKIPNDRRKSVIKQAYRYNVIDTVLALNCAFFVNIAILMLAASVFWKS
NIQVTELSEAYRLLTKLMDGKLAAVLFGLGLFLAGQSSTITGTMAGQIVMEGFIKLRIKPWLRRFITRLLAIIPAAIVII
VLGDKGTYTLLIISQVLLSIGLPFAVVPLIIFTSSYEIMGEFKNRLSIIIINSIIALFIIGLNLATIFQLINDFLHNDSI
ISKCLTIIFLIPLSIALCCLLLWLIISKINFFTNLLSKIFNNNNNNNNKNIINNNNNYSGNTINNQTIQ