TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q55471|Q55471_SYNY3 Slr0529 protein OS=Synechocystis sp. (strain PCC 6803) GN=slr0529 PE=4 SV=1
MKFFKITTLIISLIVLTSCQGPGVNGDEDRKQVTILGVMIGEQQEKIEQALAPFTEATGIEVVYEGVDTFATTLPIRVDS
GRAPDLAMFPQPGLMADFAREGKLVPLGEILTPEEMTEAYDQAWLDLAAVDGTVYGVWYRASVKSLVWFNPQEFAANGYE
VPGTWEEMMALSQRLIDKGKTPWCLGIESGNATGWVGTDWVEDIMLRTASPATYDQWVAHDIPFNDRRVENALDIFGEIT
QNEKMIYGGKVGALSTPFGDSILGLFTDPPHCYLHRQGNFIAAFLPADVDDDQVDIFPLPPIEEEYGLPILVAGDIFAMF
NDTPEARQLMAYLASSRPHEVAATLGAYISPHKNIDLNLYPDRLTRKQAEILNKAEVIRFDASDMMPGAVGTGTFWSGMV
DYIGGADGTQVLNTIERSWPR