TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q56256|Q56256_TREDN Major outer sheath protein OS=Treponema denticola OX=158 GN=msp PE=4 SV=1
MKKILAILMILVLVGGVAFAQLTPQVTAKASVNWGIDFGAGKNAKAQHGFENLLDAKVVIPLYMGTLNSKTEGDVRMNFD
LGVNLAYRFYDQLSNSASPHVAWDSDAEFKLWRKTLSDMSASIHFFGGYMNVYGRPDFSTNYAQIWSPIRDNGVAWGPET
SGDITGFGTKLGYASDDLAGTGLKFDAGLKFGSNGSWKAKGTTAQDKFKVVDLKVGDTLIAGATYYKQNGIDAEGKPIFS
STAAVFAAPPTVGAGEDGKYLVKTASTATGPAANKYAFGLDLSLGYDKWVTLDFGINATFDNVKDFGKAGVHEDVAAGSN
PDKPYLGMGLKLGSKPVDGLALTLAMDALMNVGTDSKVAFDLRFDASYKWVALGAYFGNDLSAYAGKDKNNKAIGDMAAM
IAFKSAASGDTNFVEGLAFGVDFRLNHLLSAVPTGDKSTLPMGISAWVNYKYALTDSMWVKPYANFWGETNRKSIDASKT
DKFFGVAYKVGATFSPAEKIEIDTYWSQGKLSWNKYEGTEGMISAPAFDAHNGTFVIGVKVIY