TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q56828|OMPF_XENNE Outer membrane protein F precursor (Porin OMPF) (Outer membrane protein OPNP) - Xenorhabdus nematophilus.
MKRNILAVVIPALLVAGTANAAEIFNKDGNKLDLYGKVDVRHQFADKRSSEDGDDSYARIGIKGETQISDQLTGFGRWEY
NVKAKGTEAAVAESSTRLAFAGLKFANYGSLDYGRNYRVNYDVNAWTDVLPIFGGDPMAQTDNFMTGRSTGLLTYRNTDF
FGLVDGLNFRLQYQGQNSDRTKNKGRDTERSNGDGYGLSSTYDVGYGITVGGSYANSARTADQKEKVSDAYGKRAEAWNI
GAKYDANNVYLAAMYGETRNMTRYTRTIADTDATLIANKTQNIELTAQYLFSDLGLKPSLAYVQSKGKDLTEGKGFNGDL
VKYVSVGTYYYFNKNLSTYVDYKINLLKKDNELGVNARNVFGVGLTYQF