TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q57603|Y139_METJA Hypothetical protein MJ0139 - Methanococcus jannaschii.
MNLKDRRLKKIMEVLSLIFTFEIVASFILSTYNPPYQDLLIKLDYISIMFFTFEFIYNFYYVEDKAKFFKDIYNIVDAIV
VIAFLLYSLQVFYSKAFLGLRVINLLRILVLLRIIKLRKLEENQALINFLTLLTICFIASCLIWIVESGVNPAINNFFDA
FYFTTISITTVGYGDITPKTDAGKLIIIFSVLFFISGLITSLQKALKGD