TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q57XB2|Q57XB2_TRYB2 Putative uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb927.8.2770 PE=4 SV=1
MSQSRVPIRYGAFIHLSCDEGYVTAGGLGNEGLFIRNKNELSDDAEPLPLFGFETSVFQILPPTVAKVAAEEGLSKGNRA
PNSNPLSDGVSNIYSTQQVTFGQLFVLVHAVSRLHVAALPSEPSERDPDCARLVLAPPGEIEQTFCQFIFTPRYTTHGEG
DVVCRGDEVLVQLSSIPIFLQTTVVSPTRPVKHETFGSASFPYEPTDGCGRGNSWSAGTRMALSAVLGAPEVNLSEAKAL
VFVVERYDIDRDKAEHQRILHRIPRPCVSAGVPVIFYHLEHKRVLATSVAMPPCQGGGKIGVSGVAPRGNEGGGERDHLL
KTRQTHSVMGNVTVICHASGRFAAAGSSKSQGSDSHSAGATSLDSDPCSTKGKAPDDRKRVNGVGGAALPLFAVDKGVAD
GTFSEEGALSGLQCSCTALWILENEQPTVGGAVNMNSGVYRLRQACSNLYVAVEGSAVDTILEGDGSPEGSVVSQRSCCN
LTGDIVNEEGGDVVRPTTLSMIPPPRTPKDLQRTLFRLSPMFNTDCGYLIENDCLLLQNVATDMYLCTSEGSETLSLSWK
PSNIDLIVVRRAATDVQDSVLFLWSQCETLSGYRDAFQVLTTEGTATHQQQTETDGEHGQGRYPSAEGSTSPTLMEGRMA
IVSDYNHIPESFVRPSKTCPKGSNVGTGYASLLPVICACQRTLAELIIFCSISPERNVLRRDGIPIPNHQHMLVELCVHR
LVIDVILAPFSKFGVRADRSVGKHAQCCGQWGCSSWLPPLPLSGGVVDVNDLLLKMHREIHIVCRLGFRLLRQMVRQAPE
LKAGFENYIPYFLAFDGYKLEVVDSLTRLFSENPAVRNSSLELVVNHYIAGLHLTRSGRYLQLLCSMCSVGTHGVTERQR
LVCQKLLVENANALYSFVLDSGGEWAVKTDKDEPPIPCNILFSGQQQDGGEEEGTKLREYVQSELELLGALCLDGCPPLC
REEVAKVFPSPVLLMALRNFSPKWPEVSDRSRVCDVVRSHLIRLAMHCYILPYIDDPAVQLREGAVLLGSSKLHLKVDEK
TAFSGKPDSELTQAVKEGTLHVIRSNTHFVRSDTGRSILIRAALAAWLRFVSAHQVSATETACLVPLLLELLDSRDDEAH
DGSSKIAEYTWTRLEVSEAGLLVVRAREMICQILLQILETATYRAANEINLLLHGILVTDHGASLAHQHDYCSLLRRADV
SSTGDPFVTSPTERDALLWHKGKANDGNGNRCFGLNRRKGPSDYQSTVAGSAVTTQLSGSTKDVAAFLDYVKGICSCIVR
PLRVDQLVPRLVDLAHHDGSQLAPYAMELLVRICTVRRSVARLVLQVHPFPSSEVIQCFDNMYFAAVQVRSSYIRGSVEE
AIDVALQGIDGLSTQTQNEVTGTTNEGRVDDGGTDEYYNDLTEDDEEIEEIGICEEQEVEASSSSAPEDQHEVGGESKAR
RLWSKAAGAARIVVYRNAIIARRRSVGLSETSRVPLRVVVRAETVRHWQVHITMLEMYPFIGPSSPAFSKWMRFFYVFTL
SQSNAESLKAYIDIFMGAFNLSSNCVVMGLHIVLSILATIKDPTPHLTDAFLRESARYIDGEIAALHPDGEFATKLGLHV
FTKTTVGGIPRRRMLQLLRDYDAFRCLPSPGVTEKHGRGRFTACIVEMVCRICGTSMGAVALGRSALPVTHLLEITLSYG
TSYTPLVEVPRPRALWESNSFHLLGAYLLALVSLYIAAGDAGGDGGRRQRQMEWMANRDWWSVVLLLSRQLKELTRLMQS
RTETVLWRGRRILQRYRRLWLVNLPLALLTFMTECFNEAGFYRYRDVVGATFHEMCMSVAGFSEVLLASADAIRLQAREM
VGYRRLVALLQVQTGNLVGHELLSGTMLTTRRNLRHGVICYYKKINEAEEEARGLHPDALLLAETGPQAENDGIQGGLIA
TADVPTHTQNDADDSSPMGLLISGAATKCLDAERLRGALRSLVNRDQLITMEDSTDLGEPAGIMNALLLSCRERSNVLDF
VSTTLGCMRERSFGSITLIGMLNIFSNALHTALREQERERLKHVSAENSSVITDIFTVRSFETDYAKENAGRLLQTTFSD
LGATRAIASLCAVDDQVVAYSAVQLCVGLLEGGNEHAQKALLAYFQEHQERFFHNIRDMLHKAVDWVQCTNAEHQIVVLE
RGGVVPNVSNAHEFTRMLLTNALTTPPSLYSSLKVRVGRGTAVARRRLSAWDRAGGSLNQRFVCTLFRMLQLFCEGHNLS
MQNYIRSQYDNLHSVNAVHEVMNLITEIAAVVHPATVRMLQSAFALLTELCQGPCHENQEALLGYGVCVVISKLLSRLNL
PDVTGTPSTGTGITNWGGGDSNSTDNKASVDCCTLNETDSEGNAFLRLQGGFLLSKDDAGNLRIALTQCLLSLIEGCRSR
DVFHQLLEQIPVEVIERELTTVDPGAYDSILENEELASDPGVEALFNWLIFLKTVRPYAEADYLKRIDAMLQHTNKLCTR
LGFIEIQRADGMLEKVLFRIPHVWRGLMRRNRKQMLAEINCSSRAAKLGDFMYHSDNVIFEVERSYAFQCWVERRTRWRL
DNRSSGWRGKECDAGKVDTSVDAGKPRWTPKWKQCSDAPKYFWNHFIAPVLFCTHLGFYEYSSLLVAVVLNIALINGEGR
HRNLEESQLWANIISGLCVLQLVLSLIAITVDTIVFFPVSLYVHYRQKQQRFSGRAKFNETLQGVLRGLSAKEISLLLVT
RFSFQYRLLLVVMAVLSIFVSYYFAAAHLTLMVYTFPTLRTFVSAITHNGRQLLLTALLGVMGLYLFAIAGRIMFPEQFG
SNGEVDENSGKKNDENGNCDTLLRCFTFILWQGLRQGGGVGDVMDEVSWNSSTLVPRVSYDLIFFALVNVVFLNIMFGII
IDTFGELRDDRRERENELRSTCFICGLDADTLEKGQVGGFRAHVEDAHNMWMYLYFIHYLRHKDPNEFTGQESYVHEKIQ
RNDLSFFPEEDCLALQECREGNGKRTGDDEADSDDELASSVVVGGSAPRGPKPESAHPDTGVKLVLKELAAVREAVSALA
REATMEGERTRGLAQQLELINRSSQSSSLRKFPGGGSAASVAETSTSKGTWLRHSEPEH