TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q58543|YB43_METJA Hypothetical protein MJ1143 - Methanococcus jannaschii.

MTITQMISEILMHNTVYNYILSLISIILFIVIGKYANALIERLADKLHKKSGIELDELLIRALSLPVAIAIILSGFYFGV
NFLYLLPSLKTAVNEGILTAFILCVVVFFDRFLNELVERYLALTISKKTKKDVDDQIVVLTKKLVRLVVWVVGLLLILSN
LGYDIKTLLAGLGIGGLAVALASQNLVSNLIAGLIILTDKPFKIGNWITFSGGSGIVEDIGIRSTKIRATDNSIIVVPNS
KLIDEIIQNVPSKNKWKVSTTIGVTYNTPVEKIRKAEEIIKNILLEHPNVEDEPITVYFKEFGDWSLNIQVVYYIKNSRY
NGYQKYISTINEVNLKIKEEFDRKGIEFAFPTYTLYLKRDD