TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q58752|MJK2_METJA Probable potassium channel protein 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1357 PE=4 SV=1
METSKKLVIVAVLSITLILTYAYLISIIEGVDYFTALYFSVITITTTGYGDFTPKTFLGRTLTVVYLCVGVGIVMYLFSL
IAEFIVEGKFEEFVRLKKMKNKIKTLKDHYIICGYGRLGKVVGEKFIEENIPFIAIDINEDVLKEEYEKYPDKFLYIVGD
AKKEEVLKKAKIDKAKGLIATLPSDADNVFLTLTARELNPNILITAKADEKEAIRKLKIAGANRVVSPYLIGGLRMAEVS
VRPGILDFLSTFIKIAKDEYEEDIELRKFVIEKDSELAYKSLKDANIRGKTGATILGIRREKEFCINPYPEFILKPGDVI
YAFGTEENLKYLENLVKKKKKKL