TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q58957|YF62_METJA Putative membrane protein MJ1562 - Methanococcus jannaschii.
MVVLMLREILKKVAHFSEQKPFLMLLIILIITVFAGISATNVKSQTAFEKMLPQDNPIIKTLYEVRDEFGGTDVITICIK
LKPSDSSDKVVDIRDPRVLKAIKELEDNLRYVDGITSVSSPVDIIIQKNNGIVPNDIDTVKDILNKLPEDKRKRIFNSDY
SMTVVNAYTDAGGDQKKLMRVMDDVNERIEETPFPPGVEVIATGTPPMRKLMDELMKESQSFTTTVGLIGILIILIIYFR
KPLSSIMPLLPVLIAVIWTGGAMGLLDIPLDMATAGIGSLILGLGIDYGIHLMHRYDEERRKGMPIDKAIETAVVETGTA
VMATTATTVVGFLALVLAPLPMMANLGKVCALGISFCMVVVLTLLPALIVIEERHIMPLIKRLKGDTQ