TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q59LX9|BTN1_CANAL Protein BTN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BTN1 PE=3 SV=1
MFIISETQRTFASFFIFGLLNNILYVIILSAAIDLVGPSTPKAIVLLADIIPSFSFKVAAPFFIHAVPYIIRLWTLVALS
ATGMVLISLSPTNEISWKILGITLASLSSGLGEVSFLQLTHYYEENSAIGGFSSGTGGAGLFGSFLFMVFTNVLGFPVWV
VLLICAVFPSGFIITYFNLLPLPMHEYQVILQQQQEREEEQEEEEYQQQLQDEARSQNIESIREVKYSVNYISKHVQNTI
HKITPLILPYMLPLTTVYISEYVINQGISPTLLFPLKEVPRWLISSYRDIYVVYGFLYQLGVFISRSSVTMGIRIKRLYL
LSVLQFINVMITLYQSIYDLPFHSIWWLFLLIFYEGLLGGASYVNTFKSVSEQVSRTKREFSMGCVSISDSLGIVTAGCI
NWWLELKLCHLQVARGRDWCLKGGSL