TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q59UP8|Q59UP8_CANAL Putative uncharacterized protein MEP2 OS=Candida albicans GN=MEP2 PE=4 SV=1
MSGNFTGTGTGGDVFKVDLNEQFDRADMVWIGTASVLVWIMIPGVGLLYSGISRKKHALSLMWAALMAACVAAFQWFWWG
YSLVFAHNGSVFLGTLQNFCLKDVLGAPSIVKTVPDILFCLYQGMFAAVTAILMAGAGCERARLGPMMVFLFIWLTVVYC
PIAYWTWGGNGWLVSLGALDFAGGGPVHENSGFAALAYSLWLGKRHDPVAKGKVPKYKPHSVSSIVMGTIFLWFGWYGFN
GGSTGNSSMRSWYACVNTNLAAATGGLTWMLVDWFRTGGKWSTVGLCMGAIAGLVGITPAAGYVPVYTSVIFGIVPAIIC
NFAVDLKDLLQIDDGMDVWALHGVGGFVGNFMTGLFAADYVAMIDGTEIDGGWMNHHWKQLGYQLAGSCAVAAWSFTVTS
IILLAMDRIPFLRIRLHEDEEMLGTDLAQIGEYAYYADDDPETNPYVLEPIRSTTISQPLPHIDGVADGSSNNDSGEAKN