TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5A8J5|Q5A8J5_CANAL Putative uncharacterized protein STL1 OS=Candida albicans GN=HGT10 PE=4 SV=1
MGGFIDNIFKRTTTAGLTGRKLRAAVTITATLGFSLFGYDQGLMAGLISAEQFNWEFPATKDNSVIQGAVTASYELGCFF
GAIFALLRGDALGRKPIIFFGATIIILGTIISVTPFRPHWPLGQFVVGRVITGIGNGMNTATIPVWQSEMSKPENRGKLV
NLEGAVVAFGTFIAYWLDFGLSYVDSSVSWRFPVAFQIFFALWVIFGIIQLPESPRWLISKDRKPEAFEVLAALNDTTPD
DDAIVAEASVIIDAVRRNAKVQAGFKDLFTGGKTAHFQRMLIGSSTQFFQQFTGCNAAIYYSTLLFYETVFHHTKYRLSM
ILGGVFATIYALATLPSFFLIDTLGRRNLFLIGAIGQGISFLISFACLINPTEQNAKGAAVGIYLFIVFFAFTILPLPWI
YPPEINPLRTRTTASAVSTCTNWLTNFAVVMFTPPFISASGWGCYLYFAVMNFLFVPIIFFFYPETAGRSLEEIDIIFAK
AYVEKRQPWRVAATLPKLSLQEVEDESKSLGLYDDDFEKDNFETKEDVSDGTASNSNGVFEKPENV