TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5F3Q8|Q5F3Q8_CHICK SSD domain-containing protein OS=Gallus gallus OX=9031 GN=SCAP PE=2 SV=1
MTLTEKLRERISRAFYNHGLLCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFSTPVKDYFPPSPDVVSQQGDLSE
RPDWYVGAPVAYIQQIFVKATVSPWQKNFLAVDVFRSPLSRVFQLVEEIRNHALRDSSGVKSLEEVCLQVTDLLPGLKKL
RNLLPEHGCLLLSPGNFWQNDRERFNADPDIIKTIHQHEPKALQTSATLKDLLFGLPGKYSGVNLYNRKRVVSYTVTLGL
QRYDSRFLSSLRSRLKLLHPSPNCTLREDSIVHVHFKEEIGIAELIPLVTTYIILFAYIYFSTRKIDMVKSKWGLALAAV
VTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSNESWSIMKNMATEL
GIILIGYFTLVPAIQEFCLFAVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPAEACLPPAKPASRSQRYERQPAV
RPATPHTITLQPSSFRNLRLPKRLRVIYFFARTRLAQRLIMAGTVIWIGILVYTDPAGLRTYLTSQVTEQSPLGEAGLPP
MPVPGGVLPAGDPKIDLSVFPSDPIQLSENQTQQREQQAGLEPLGRLETNQHSWAQGPEGRGNGQTELGTEAEVTWGAED
EEIWRKLSFRHWPSLFSYYNITLAKRYISILPAIPVTLYLNPQEALEVRHPQEANRYHPFLSSSGGKLNAEAQPDQTSSR
LQGHRDVTLYK