TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5G3M3|Q5G3M3_ENTFL Single-stranded DNA-binding protein OS=Enterococcus faecalis GN=pcfS PE=3 SV=1
MINNVTLVGRLTKDCDLRYTSSGVAVAAFTLAVNRNFTNQNGEREADYIQCVIWRKPAETLANYTRKGTLVGLVGRLQTR
NYENQQGQRIYVTEVVVESFQLLESKEVSQQRGVNASNPTPVGQQESNTQQPFPDLEGSSIEISDHDLPF