TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5H1F8|Q5H1F8_XANOR Outer membrane receptor proteins, mostly Fe transport OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=CirA PE=4 SV=1
MAAGQIIYNPMKNSFLANSPSPQPLFRPLLAFAALTATMGTALTAHAQSAGATAPSTTTASASTLPSVRVLGDSDSDSRQ
VGDRSEITLNPQALPTTVQHIGQEDIANTNVGRDVSNIFRRVPGVLANNIDQGDTGNGFRMRGFATQGTHGADTAVYVDG
VPQNIPSIQSIASHGAVFLEWLPPELIGGIDVIKGPVSALYGDQNRAGAVDIRTRDGGDATPSSVSVSAERYGLRRTALV
LSNKLSQVDSLLVADLSRNDGYRYASNTDRESLSWKLSTQQDSGKYSLRLTRYVSDFQAAGYLALSDLQKGLDPRSTQFN
NPGFGAARRTSVVVNRAPTAGEEGWYATAYGESLYRQRAVATSATRHLLGEDDRDMYGARVYHNTVFGDASLAVGTELRK
DSGSAFRRIYVNRLPSANYANDVDLDLVTYGFFAQGQWRATRDLKLSAGARYDRFDYDIANLKLPAASTGYRKGVLTPKL
GASWTVLPRLELFANVAEGMRSPATEQISSSGATGPLGASGGVISQVKPSKVRSYDMGFTANPTTDVMVSGSAYDILNSD
EIVSQADGSFRSVGDTTRKGVELETRWQLGTASSVYASVGRILEAKVNNPAANTGAKLSVPGVQFKAGAQHKFGLGAGQM
TLNADAYLIDDIPYYVGTPTTQERTMPLYTRYDVRSTYDYGPAQFSLYATFQPQRYGSEIAYGTAAGLLVSPVPKTTVGA
TLRYFF