TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5K1Z4|Q5K1Z4_ACIBA 33-36 kDa outer membrane protein OS=Acinetobacter baumannii GN=omp33-36 PE=4 SV=2
MKKLGLATAVLLAMTGAHAYQFEVQGQSEYVDTTANDKNFTGTAQGTYYFKNVDASKGPLAEAAFLNQASNVSVAYNYIK
YDEKDTVNVESHTYGVKGEAYLPTPYLPVYASASYNHTINDFKDGVSDDNGDRYALEAGAMLLPNFLVAVGYTSVADQVS
LDAFGVNKYGIAKAVGESVAIDEKQDAVTARTKYVGNIDGTNMAIGFEAFGVFAEDNAYGMKTDLFVTPKLSVGASFADV
SAFNSGYDHVWGGHTQYFITPAVAVGADFVKANAKDGNPRDTQTIGLNAKFRF