TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5SIR2|Q5SIR2_THET8 Sugar ABC transporter, permease protein OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) OX=300852 GN=TTHA1302 PE=3 SV=1
MEEALLRAVLFGTPILLAGLGALLAERSGVVNLGVEGMMALAALTAFAAAQAYGPLPGVLAALGVGALSGLFLGLFAVTL
RANQFVAGLAVAALGLGASGLLGKRYEGLPLAHPLPEGGFALLGAALALLVHLFLTRTRTGLFLRSAGENPKAVDLFGVS
VDGVRYLALGLGGGLIGLAGAYLSLAYRPSWTDGMTAGLGWVAIALVILAAWHPLRALLGAYFFGLLFFLQFRLQGSVPI
PSEAFAAMPYLLVILVLALSGRSRAPKALGQPFERGR